PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00048.68
Common NameAMTR_s00048p00125480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 163aa    MW: 18136.3 Da    PI: 6.2388
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00048.68genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.25.8e-31152455
                                  G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                             +rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  evm_27.model.AmTr_v1.0_scaffold00048.68  1 MRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 52
                                             79*************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015572.6E-23152IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.5E-27152IPR009057Homeodomain-like
SuperFamilySSF466892.69E-14153IPR009057Homeodomain-like
PfamPF002495.0E-7151IPR001005SANT/Myb domain
PROSITE profilePS512949.094155IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MRWTSSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTVKTTDRAA  60
GSSGEIDIFG NGTPGEISNE ILLENMTQRP PLQHGLDYCN MWSNSSSRRN WLQAKSRDSM  120
SMSPSSEVKG GLEDTSDELF EISSSDMNQK KPNLEFTLGR PD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854082.21e-117PREDICTED: probable transcription factor KAN2
SwissprotQ9C6163e-44KAN2_ARATH; Probable transcription factor KAN2
TrEMBLU5CZG91e-119U5CZG9_AMBTC; Uncharacterized protein
STRINGVIT_02s0012g01940.t013e-54(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.13e-42G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]